Loading... Please wait...

Categories

Our Newsletter


IGF-1 LR3 1mg Long R3 Receptor Grade (Not Part of BOGO Deal)

  • Image 1
Price:
$69.99
Availability:
In Stock
Shipping:
Calculated at checkout
Quantity:


Product Description

 

CAS: 946870-92-4

Formula: C990H1528N262O300S7

Molecular weight: 9200

Peptide purity: > 98.0%

Appearance: White powder

Related substance: Total Impurities(%) ≤ 2.0%

Acetate content: ≤ 15.0%

Bacterial Endotoxins: ≤5 IU/mg

Chain:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

 

 

 

 

 





Find Similar Products by Category


Write your own product review

Product Reviews

This product hasn't received any reviews yet. Be the first to review this product!


Add to Wish List

Click the button below to add the IGF-1 LR3 1mg Long R3 Receptor Grade (Not Part of BOGO Deal) to your wish list.

You Recently Viewed...